Streptococcus thermophilus CNRZ1066: str0203 Help Entry str0203           CDS       T00212                                  Symbol groES Name (GenBank) chaperonin, 10 kDa   KO K04078   chaperonin GroES Organism stc  Streptococcus thermophilus CNRZ1066 Brite KEGG Orthology (KO) [BR:stc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:stc03110]     str0203 (groES)    03029 Mitochondrial biogenesis [BR:stc03029]     str0203 (groES) Chaperones and folding catalysts [BR:stc03110]  Heat shock proteins   HSP10    str0203 (groES) Mitochondrial biogenesis [BR:stc03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     str0203 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 HupF_HypC PriA_3primeBD Motif Other DBs NCBI-ProteinID:  AAV61817 LinkDB All DBs Position 211308..211610 Genome browser AA seq 100 aa AA seqDB search MEVIGMALKPLGDRIIVRFEETEEKTASGFVLAGASHETTKTAEVLAVGEGTRTLTGELI APSVAVGDKVLVENGTGISVKDGEDYVSIIREADILAVLA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt ttggaggtaattggtatggcattaaaaccattgggcgatcgtatcatcgtccgttttgaa gaaacagaagaaaaaacagctagtggctttgtattggcaggagctagtcatgaaacaact aagactgcagaggtcttggcggtaggtgaaggtacccgtactcttactggggaattgatt gcacctagtgttgcagtaggcgataaggtccttgttgaaaatggtacaggtatcagtgtt aaagacggagaagattacgtttcaattatccgtgaagcagatattttagcagtcctagct taa

DBGET integrated database retrieval system