Streptomyces sp. CMC78: SCMC78_32620 Help Entry SCMC78_32620      CDS       T11197                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stcm  Streptomyces sp. CMC78 Pathway stcm00998   Biosynthesis of various antibiotics stcm01100   Metabolic pathways stcm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stcm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SCMC78_32620    00074 Mycolic acid biosynthesis     SCMC78_32620   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SCMC78_32620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BFP53455 UniProt:  A0AB33KP76 LinkDB All DBs Position complement(3611573..3611833) Genome browser AA seq 86 aa AA seqDB search MTSAVQTLDLEQLREIIAEVLDVETADVGDDTSFTDDLEIDSLMALEVVVVLEKRYRVKL REEELKQVTCLRAAYGLIAQKLADPR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacatccgccgtgcagacactggacctggagcagctgcgcgagatcatcgccgaggtg ctcgacgtggagaccgcggacgtcggtgacgacacgagcttcaccgacgacctggagatc gactcgctgatggccctggaggtcgtcgtggtgctggagaagaggtaccgcgtcaaactc cgcgaggaggagctgaagcaggtgacctgcctgcgcgccgcgtacggcctgatagcgcag aagctggcggacccccggtga

DBGET integrated database retrieval system