Streptomyces sp. CMC78: SCMC78_36690 Help Entry SCMC78_36690      CDS       T11197                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism stcm  Streptomyces sp. CMC78 Pathway stcm00261   Monobactam biosynthesis stcm01100   Metabolic pathways stcm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stcm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SCMC78_36690  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:stcm01008]     SCMC78_36690 Polyketide biosynthesis proteins [BR:stcm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SCMC78_36690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BFP53862 UniProt:  A0AB33KDB1 LinkDB All DBs Position complement(4058013..4058231) Genome browser AA seq 72 aa AA seqDB search MSNPFEDAEGTYYVLVNAENQHSLWPGHVEVPAGWTQAFGAADREKCLAYIEETWTDMRP QSLVDAMESAGR NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtgagcaaccccttcgaggacgccgagggtacgtactacgtgctggtgaacgccgagaac cagcactcgctgtggcccggccacgtcgaggtgcccgccggctggacgcaggcgttcggc gccgccgaccgggagaagtgcctggcgtacatcgaggagacctggacggacatgcggccg cagagcctcgtggacgcgatggagagcgccggtcgctga

DBGET integrated database retrieval system