Streptomyces sp. CMC78: SCMC78_53240 Help Entry SCMC78_53240      CDS       T11197                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stcm  Streptomyces sp. CMC78 Pathway stcm00998   Biosynthesis of various antibiotics stcm01100   Metabolic pathways stcm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stcm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SCMC78_53240    00074 Mycolic acid biosynthesis     SCMC78_53240   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SCMC78_53240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BFP55517 UniProt:  A0AB33KLL9 LinkDB All DBs Position complement(5918132..5918380) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVKGLAEIVNEIAGIPEEDVELGKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAADYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcgtcaagggtctcgccgagatcgtcaacgagatcgcc ggtatcccggaggaggacgtcgagctgggcaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccc gacgaggacgtcaagaacctcaagacggtcggcgacgctgccgactacatcctgaagcac cagggctga

DBGET integrated database retrieval system