Streptomyces sp. CA-256286: JHY03_38000 Help Entry JHY03_38000       CDS       T11337                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism stcz  Streptomyces sp. CA-256286 Pathway stcz00253   Tetracycline biosynthesis stcz01056   Biosynthesis of type II polyketide backbone stcz01100   Metabolic pathways stcz01110   Biosynthesis of secondary metabolites Module stcz_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:stcz00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     JHY03_38000    00253 Tetracycline biosynthesis     JHY03_38000  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:stcz01004]     JHY03_38000    01008 Polyketide biosynthesis proteins [BR:stcz01008]     JHY03_38000 Lipid biosynthesis proteins [BR:stcz01004]  Polyketide synthase   Component type    JHY03_38000 Polyketide biosynthesis proteins [BR:stcz01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      JHY03_38000     Nonaketide PKS      JHY03_38000     Decaketide PKS      JHY03_38000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QTA33611 UniProt:  A0AAT9L3K1 LinkDB All DBs Position 4262882..4263154 Genome browser AA seq 90 aa AA seqDB search MDSNQTFTLESLKRILREGAGADESVDFDGDILDADFEELGYESLAILETCGRIEREYGI TLDDSVVSDVRTPRRMVEVVNEHLGQTAPA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggacagcaaccagaccttcaccctggagagcctcaagcgcatcctgcgcgagggggcc ggcgccgacgagagcgtcgacttcgacggcgacatcctcgacgcggacttcgaggagctg gggtacgagtccctggcgatcctggagacgtgcggccggatcgagcgcgagtacggcatc acgctggacgactcggtggtcagtgacgtgcggacgccgcgccgcatggtcgaggtcgtg aacgagcacctggggcagacggccccggcctga

DBGET integrated database retrieval system