Streptococcus pseudopneumoniae: SPPN_00595 Help Entry SPPN_00595        CDS       T01590                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism std  Streptococcus pseudopneumoniae Pathway std01100   Metabolic pathways std01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:std00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SPPN_00595    00074 Mycolic acid biosynthesis     SPPN_00595   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SPPN_00595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7975 DUF6137 DUF6315 Motif Other DBs NCBI-ProteinID:  AEL09563 LinkDB All DBs Position 85212..85445 Genome browser AA seq 77 aa AA seqDB search MTEKEIFDRIVTIIQERQGEDFVVTEALSLKDDLDADSVDLMEFILTLEDEFNIEISDEE IDQLQSVEDVVKIIQAK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgacagaaaaagaaatttttgaccgtattgtgaccattatccaagagcgacagggagag gactttgtagtgaccgaagctttgagtctgaaagacgatttggatgctgactcagttgac ttgatggagtttatcttgacgctggaagatgaatttaatatcgaaatcagcgatgaggaa attgaccaactgcaaagtgtagaagatgtggttaaaatcattcaagcaaaataa

DBGET integrated database retrieval system