Sporomusa termitida: SPTER_04250 Help Entry SPTER_04250       CDS       T06115                                  Name (GenBank) 4Fe-4S binding domain protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sted  Sporomusa termitida Pathway sted00020   Citrate cycle (TCA cycle) sted00720   Other carbon fixation pathways sted01100   Metabolic pathways sted01110   Biosynthesis of secondary metabolites sted01120   Microbial metabolism in diverse environments sted01200   Carbon metabolism sted01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:sted00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     SPTER_04250   09102 Energy metabolism    00720 Other carbon fixation pathways     SPTER_04250 Enzymes [BR:sted01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      SPTER_04250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_9 Fer4_10 Fer4_2 Fer4_6 Fer4_16 Fer4_21 Fer4_8 Fer4_4 Fer4_17 Fer4_22 Fer4_3 Fer4_13 Fer4_15 C1-like_CT Motif Other DBs NCBI-ProteinID:  QDR79157 UniProt:  A0A517DPD6 LinkDB All DBs Position 482615..482800 Genome browser AA seq 61 aa AA seqDB search MLKTKPRFCKGCGICVEFCPKKVLKLDDLAKIEVAQPDDCVACGQCELRCPDYAIFVIAD K NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgctgaaaactaagccccggttttgcaaaggatgtggcatttgtgttgagttttgtccc aagaaggtactgaagctggatgaccttgccaaaatagaggtcgctcagccggatgactgt gtggcttgcgggcaatgtgaattaagatgtcctgattatgctatttttgtcattgctgat aagtaa

DBGET integrated database retrieval system