Stenotrophomonas sp. SBJS02: FQS62_004695 Help Entry FQS62_004695      CDS       T10678                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stej  Stenotrophomonas sp. SBJS02 Pathway stej01100   Metabolic pathways stej01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stej00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FQS62_004695 (acpP)    00074 Mycolic acid biosynthesis     FQS62_004695 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FQS62_004695 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WAP02800 LinkDB All DBs Position 1018432..1018671 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTNSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKISTVQAAIDYVKAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacagcttggcgtcaaggaa gaagaagtcaccaacagcgcatcgttcgtcgatgacctgggcgctgactcgctggacacc gtcgagctggtgatggccctggaagaagaattcgagtgcgagatcccggacgaagaagcc gagaagatcagcaccgtgcaggccgccatcgactacgtcaaggcccacgtcaaggcctga

DBGET integrated database retrieval system