Stenotrophomonas sp. SBJS02: FQS62_018410 Help Entry FQS62_018410      CDS       T10678                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism stej  Stenotrophomonas sp. SBJS02 Pathway stej00290   Valine, leucine and isoleucine biosynthesis stej00650   Butanoate metabolism stej00660   C5-Branched dibasic acid metabolism stej00770   Pantothenate and CoA biosynthesis stej01100   Metabolic pathways stej01110   Biosynthesis of secondary metabolites stej01210   2-Oxocarboxylic acid metabolism stej01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:stej00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     FQS62_018410    00660 C5-Branched dibasic acid metabolism     FQS62_018410   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     FQS62_018410   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     FQS62_018410 Enzymes [BR:stej01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      FQS62_018410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  WAP01270 LinkDB All DBs Position 3983597..3983848 Genome browser AA seq 83 aa AA seqDB search MQYRLDLVLHPAEGALLRVIGMAERRGFAPRAISGAPVAADDGRWHLQLVVDGQRPAETL CRQIEKIYDCVSVQVTAVEGVAP NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcaataccggcttgacctggtgctgcacccggccgaaggcgcgctgctgcgcgtgatc ggcatggccgaacgccgtggctttgcgccgcgtgcgatcagcggcgcaccggtggccgcc gacgatggccgctggcacctgcagctggtggtggacggccagcgcccagcggaaacgctg tgccggcagatcgagaagatctacgactgcgtgtccgtgcaggtcaccgccgtggaagga gtagccccatga

DBGET integrated database retrieval system