Stenotrophomonas sp. KCTC 12332: AXG53_05345 Help Entry AXG53_05345       CDS       T04408                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism stek  Stenotrophomonas sp. KCTC 12332 Brite KEGG Orthology (KO) [BR:stek00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:stek03036]     AXG53_05345 Chromosome and associated proteins [BR:stek03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AXG53_05345 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ZapB Taxilin FAZ1_C Stathmin CC_Bre1 Dynamitin Mod_r SKA2 Herpes_BLRF2 COG3_N YabA MctB SWIRM-assoc_1 Motif Other DBs NCBI-ProteinID:  AMJ56132 LinkDB All DBs Position 1251510..1251731 Genome browser AA seq 73 aa AA seqDB search MDSFDPAGQLQALVSRLELLLERNQRLSDENRSLRQQQEQLISERSQLLTKNEQARSRVE AMITRLKSLEQHT NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggactccttcgaccccgctggccaactacaggcccttgtctcccgcctcgagctgctg ctcgagcgcaaccagcggctgagcgatgaaaaccgcagcctgcgccagcagcaggaacag ctcatcagcgagcgctcgcagctgctgaccaagaacgagcaggcccgctcgcgggtggaa gccatgatcacccgcctcaagtcgctggagcagcacacgtga

DBGET integrated database retrieval system