Stenotrophomonas sp. KCTC 12332: AXG53_12550 Help Entry AXG53_12550       CDS       T04408                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stek  Stenotrophomonas sp. KCTC 12332 Pathway stek01100   Metabolic pathways stek01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stek00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AXG53_12550   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AXG53_12550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  AMJ57380 UniProt:  A0A126NK62 LinkDB All DBs Position complement(2958079..2958318) Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKIGTVQAAIDYVKAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaagattgttgttgagcagcttggcgtcaaggaa gaagaagtcaccaccagcgcatcgtttgtcgatgacctgggtgcagactcgcttgacacc gttgagctggtgatggcgctggaagaagagttcgagtgcgaaatcccggacgaggaagcc gagaagatcggtaccgtccaggccgccatcgactacgtcaaggcacacgtcaaggcctga

DBGET integrated database retrieval system