Stenotrophomonas sp. KCTC 12332: AXG53_12590
Help
Entry
AXG53_12590 CDS
T04408
Name
(GenBank) ATPase
KO
K03924
MoxR-like ATPase [EC:3.6.3.-]
Organism
stek
Stenotrophomonas sp. KCTC 12332
Brite
KEGG Orthology (KO) [BR:
stek00001
]
09190 Not Included in Pathway or Brite
09191 Unclassified: metabolism
99980 Enzymes with EC numbers
AXG53_12590
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
AAA_3
AAA_lid_2
AAA_5
AAA
RuvB_N
bpMoxR
MCM
Sigma54_activat
nSTAND3
Mg_chelatase
Motif
Other DBs
NCBI-ProteinID:
AMJ58753
LinkDB
All DBs
Position
2965499..2966425
Genome browser
AA seq
308 aa
AA seq
DB search
MLTEVTLQSLSTAQQQVNSLLLGKAQEVRLAFVALLSSGHLLIEDLPGLGKTTLAHAMAS
SLGLQFQRVQFTSDLLPADVLGISVYEAHSRSFQFHPGPVFCNLLLADEINRAPPRTQSA
LLEAMAEQQVTLDGVTHSLPDPFFVIATQNPVDMSGTFPLPDSQLDRFLLRLTLGYPNAE
AERALLAGEDRRNLIARVTPCLSEQDLRSLREAVGQVHASDALIDYVQALITRSRQHPGV
RVGLSPRAGIALLRAAKAHALLLGRRHVVPEDVQALFIAVAGHRLVGEAEASSGPALARA
ILHSVQVD
NT seq
927 nt
NT seq
+upstream
nt +downstream
nt
atgctaaccgaagtaacactacagtccctatcgacggcgcaacagcaggtcaattcccta
cttctgggcaaagcgcaggaagtaaggctggcctttgtcgcgctgctgtccagcggacat
ctgctgatcgaagacctgcccggcctgggcaagaccaccctggcccatgccatggcgtcc
agcctcggcctgcagttccagcgcgtgcagttcacctcggatctgctgcccgccgatgtg
ctcggcatctcggtttacgaagcgcacagccgcagcttccagttccatcccgggccggtg
ttctgcaacctgctgctggccgacgagatcaaccgcgcgccgccacgcacgcagagcgcg
ctgctcgaagccatggccgagcagcaggtgaccctggatggcgtcacccacagcctgcca
gacccgttttttgtgattgccacccagaacccggtggacatgtccggcaccttcccgctg
ccggactcgcagctggaccgcttcctgctgcgcctgaccctgggctatcccaacgccgaa
gccgagcgcgccctgctggctggcgaagaccgtcgcaacctcatcgcccgcgtcaccccc
tgcctctccgagcaggacctgcgcagcctgcgcgaagcggtgggccaggtgcatgccagc
gatgcactgattgattacgtgcaggccttgatcacccgcagccgccaacaccccggcgtg
cgtgttggcctgtcaccgcgtgccggcatcgccctgctgcgcgcggccaaggcgcatgcg
ctgctgcttggccgccgccatgtggtacccgaagacgtgcaggccttgttcatcgccgta
gccggacatcgcctggtcggcgaggcggaggcctcttcaggcccggccttggcacgcgcc
atcctgcacagcgtgcaggtggattga
DBGET
integrated database retrieval system