Stenotrophomonas sp. KCTC 12332: AXG53_13070 Help Entry AXG53_13070       CDS       T04408                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism stek  Stenotrophomonas sp. KCTC 12332 Brite KEGG Orthology (KO) [BR:stek00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:stek03032]     AXG53_13070    03036 Chromosome and associated proteins [BR:stek03036]     AXG53_13070    03400 DNA repair and recombination proteins [BR:stek03400]     AXG53_13070 DNA replication proteins [BR:stek03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AXG53_13070 Chromosome and associated proteins [BR:stek03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AXG53_13070 DNA repair and recombination proteins [BR:stek03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AXG53_13070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AMJ57462 UniProt:  A0A126NPG6 LinkDB All DBs Position complement(3056642..3056914) Genome browser AA seq 90 aa AA seqDB search MNKTELIDGVAGAADLSKAEAGRAVDAVIAEITKALKKGEAVTLVGFGTFQVRERAARTG RNPKTGEEIKIAAAKNPAFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagaccgaattgattgatggcgttgccggtgctgctgacctgtccaaggctgaa gctggccgtgcggttgatgccgtcatcgccgagatcaccaaggccctgaagaagggtgag gccgtgactctggtgggcttcggtacgttccaggttcgcgagcgcgctgcacgcaccggt cgcaacccgaagaccggcgaagagatcaaaatcgctgctgcaaaaaatcctgccttcaag gctggtaaagctctgaaagacgctgtaaactaa

DBGET integrated database retrieval system