Stenotrophomonas sp. KCTC 12332: AXG53_17015 Help Entry AXG53_17015       CDS       T04408                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stek  Stenotrophomonas sp. KCTC 12332 Pathway stek01100   Metabolic pathways stek01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stek00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AXG53_17015    00074 Mycolic acid biosynthesis     AXG53_17015   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AXG53_17015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PIN Motif Other DBs NCBI-ProteinID:  AMJ58847 UniProt:  A0A126NPN4 LinkDB All DBs Position complement(3946720..3946989) Genome browser AA seq 89 aa AA seqDB search MSQQNEAERELAGLLVESLNLEDVDPAQIDPEAALFNEGLGLDSIDALELALAISKRYGF QLRSDNEDNRRIFGSLRALSAHVQANKTN NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcgcaacagaatgaagccgagcgcgagctggccgggttgctggtcgaaagcctgaac ctggaagacgtggacccggcccagatcgacccggaagccgccttgttcaacgagggcctg gggctggattcgatcgatgcgctggaactggcgctggccatcagcaagcgctatggcttc cagctgcgctcggacaacgaggacaaccgccgcatcttcggttccctgcgcgccctgtcg gcgcacgttcaagccaacaagacgaattga

DBGET integrated database retrieval system