Allostella sp. ATCC 35155: STAQ_20990 Help Entry STAQ_20990        CDS       T07954                                  Symbol acpP_2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stel  Allostella sp. ATCC 35155 Pathway stel00998   Biosynthesis of various antibiotics stel01100   Metabolic pathways stel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     STAQ_20990 (acpP_2)    00074 Mycolic acid biosynthesis     STAQ_20990 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     STAQ_20990 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF5783 DUF1493 Motif Other DBs NCBI-ProteinID:  BBK37021 LinkDB All DBs Position 2238852..2239088 Genome browser AA seq 78 aa AA seqDB search MSDVAERVKKIVVEHLGVEEAKVTENASFIDDLGADSLDTVELVMAFEEEFSIEIPDDAA EKIATVKDAIDFITKKQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtcgccgaacgagttaagaagatcgtggtggagcatctcggtgtcgaggaa gccaaggtcaccgagaacgccagcttcatcgacgatctgggcgccgacagcctcgacacg gtcgaactggtgatggccttcgaggaggaattctcgatcgagatccccgacgacgccgcc gagaagatcgcgacggtcaaggacgcgatcgacttcatcacgaagaagcaggcctga

DBGET integrated database retrieval system