Stella sp. ATCC 35155: STAQ_49970 Help Entry STAQ_49970        CDS       T07954                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism stel  Stella sp. ATCC 35155 Pathway stel00998   Biosynthesis of various antibiotics stel01100   Metabolic pathways stel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     STAQ_49970   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     STAQ_49970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BBK39919 LinkDB All DBs Position complement(5267945..5268211) Genome browser AA seq 88 aa AA seqDB search MEIERVRQILVDALEIGSVAAIYEPAIRGPFLSGEDDLSFDRLDMDSLARMELCIAIEVE TGVSLTPDDLDSFRSLGALARRVVADHA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggagatcgagcgagtccgtcagattctggtcgacgccctggagatcggctcggtcgcc gcgatctacgagccggcgatccgcggccccttcctgtcgggggaggacgacctgtcattc gaccggctcgacatggacagcctcgcacggatggaactctgcatcgcgatcgaggtcgag accggcgtgtcgctgacacccgacgatctcgattccttccgctcgctgggcgccctcgcg cgccgggtcgtcgccgaccacgcctga

DBGET integrated database retrieval system