Stenotrophomonas sp. MYb57: CLM74_17285 Help Entry CLM74_17285       CDS       T05384                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism stem  Stenotrophomonas sp. MYb57 Brite KEGG Orthology (KO) [BR:stem00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:stem03036]     CLM74_17285 Chromosome and associated proteins [BR:stem03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     CLM74_17285 SSDB OrthologParalogGFIT Motif Pfam:  ZapB SPC25_N Taxilin Stathmin Mod_r ZapB_rel YabA DUF8429 bZIP_1 T4SS_LegC2C7 DUF3450 FAZ1_C HrpB7 GIT_CC CC_Bre1 UPF0449 NRBF2 HALZ Motif Other DBs NCBI-ProteinID:  AVJ34408 LinkDB All DBs Position 3800528..3800749 Genome browser AA seq 73 aa AA seqDB search MEPADPLAQLQAFAARVEALLDRNQRLAEENRSLRHQQEQLVAERSTLLAKNEQARSRVE AMITRLKSLEQHT NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggaacccgccgatccccttgcccagctgcaggccttcgccgcccgtgtggaggcgttg ctcgaccgcaaccagcggctggccgaggagaaccgcagcctgcgccaccagcaggaacag ctggtggccgagcgctcgacgctgctggccaagaacgagcaggcgcgttcgcgggtggaa gcgatgatcacccggctcaaatccctggagcagcacacatga

DBGET integrated database retrieval system