Stenotrophomonas sp. MYb57: CLM74_20635 Help Entry CLM74_20635       CDS       T05384                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stem  Stenotrophomonas sp. MYb57 Pathway stem01100   Metabolic pathways stem01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stem00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CLM74_20635    00074 Mycolic acid biosynthesis     CLM74_20635   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CLM74_20635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AVJ35024 LinkDB All DBs Position complement(4535029..4535286) Genome browser AA seq 85 aa AA seqDB search MQALEHEIKELIISSLSLEDITPEDIDPTAPLFVEGLGLDSIDALELGLALQKKYGVSLS ADSEETRRHFSSVRALGEFVAARQS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgcaagcacttgagcacgagatcaaggaattgatcatttcctcgctttcactggaggac atcaccccggaggacatcgatccgaccgcgcctctgttcgtggaaggcctcggcctggac tcgatcgatgcactggaactgggcctggcgctgcagaagaagtacggtgtcagcctctcg gccgactcggaagaaacccgtcgccatttctccagcgtgcgcgcgctcggcgagttcgtc gccgcccgccagtcgtaa

DBGET integrated database retrieval system