KEGG   Stenotrophomonas sp. WZN-1: CCR98_14615
Entry
CCR98_14615       CDS       T04963                                 
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
sten  Stenotrophomonas sp. WZN-1
Brite
KEGG Orthology (KO) [BR:sten00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sten03016]
    CCR98_14615
Enzymes [BR:sten01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     CCR98_14615
Transfer RNA biogenesis [BR:sten03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    CCR98_14615
 Prokaryotic type
    CCR98_14615
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2 Pus10_C
Other DBs
NCBI-ProteinID: ARZ75348
LinkDB
Position
complement(3075536..3076444)
AA seq 302 aa
MTRIQFRRLDGILLLDKSTGMSSNAALQVARRLFRAEKGGHTGSLDPLATGLLPLCFGEA
TKIAGLLLGSAKAYDAEIVLGQTTDTDDAEGQVLLQRPVPAISTEALQAALAPLTGSIRQ
RAPIYSALKQGGEPLYVKARRGDVIEAPEREVQVHAIEVLEQQPERLRLRVTCGSGTYIR
SLARDLGESLGCGAHISALRRLWVEPFREPAMVTLDQLRAMVEAGDEAGMDALLLPLAAG
LAEYPRVDLDADQAHRFCVGQRQRDLSWPRGLVAVFGPDDAVQGLGQVDDSGLLAPQRRF
NL
NT seq 909 nt   +upstreamnt  +downstreamnt
atgacccgaattcagttccgccgcctggatggcatcctgctgctcgacaagtcgaccggc
atgagctccaacgctgccctgcaggtggcgcgccgcctgttccgcgccgagaaggggggg
cataccggcagcctcgacccgctggccaccggcctgctgccgctgtgcttcggtgaggcg
accaagatcgccggcctgctgctgggttcggccaaggcctacgacgccgagatcgtgctc
ggccagaccaccgataccgacgatgccgaaggccaggtgctgctgcagcgcccggtgccg
gcgatcagtaccgaggccctgcaggctgcgttggcgccgctgaccggcagcatccgccag
cgcgccccgatctattcggcgctgaagcagggcggtgaaccgctgtatgtgaaggcccgc
cgcggcgacgtcatcgaagcgcccgaacgcgaggtgcaggtgcacgccatcgaggtgctg
gagcagcagccggaacggctgcggctgcgcgtgacctgcggctcgggtacctacatccgc
agcctggcccgcgatctcggcgaaagcctgggctgcggcgcccacatcagcgccctgcgc
cggctctgggtcgagccgttccgcgagcccgccatggtcacgctggaccagctgcgggcg
atggtcgaggccggtgacgaggccggcatggatgcgctgctgctgccgctggcggccggc
ctggctgaatacccgagggtcgacctggatgccgaccaggcccaccggttctgtgtcggc
cagcgccagcgcgacctgtcctggccgcgcggcctggtggcggtgtttggtccggacgat
gctgtccagggcctgggccaggtcgacgacagtggcctgctggccccgcagcgccgtttc
aacctctga

DBGET integrated database retrieval system