Stenotrophomonas sp. WZN-1: CCR98_20335 Help Entry CCR98_20335       CDS       T04963                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sten  Stenotrophomonas sp. WZN-1 Pathway sten01100   Metabolic pathways sten01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sten00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CCR98_20335    00074 Mycolic acid biosynthesis     CCR98_20335   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CCR98_20335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ARZ76410 LinkDB All DBs Position complement(4358767..4359024) Genome browser AA seq 85 aa AA seqDB search MQALEHEIKELIISSLSLEDITPEDIDPTAPLFVEGLGLDSIDALELGLALQKKYGVSLS ADSEETRRHFSSVRALGEFVAARQS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgcaagcacttgagcacgagatcaaggaattgatcatttcctccctttcgctggaggac attacgccggaggacatcgatccgaccgcgccactgttcgtcgagggccttggcctggat tcgatcgacgcgctggagctgggcctggcgctgcagaagaagtacggtgtcagcctctcg gccgattcggaagaaacccgtcgccatttctccagcgtgcgcgcgctcggcgagttcgtc gccgcccgccagtcgtaa

DBGET integrated database retrieval system