Stenotrophomonas sp. Pemsol: PEM_17775 Help Entry PEM_17775         CDS       T10809                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism steo  Stenotrophomonas sp. Pemsol Pathway steo01100   Metabolic pathways steo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:steo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PEM_17775    00074 Mycolic acid biosynthesis     PEM_17775   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PEM_17775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AYA92500 LinkDB All DBs Position complement(3846196..3846453) Genome browser AA seq 85 aa AA seqDB search MQALEHEIKELIISSLSLEDITPEDIDPTAPLFVEGLGLDSIDALELGLALQKKYGVSLS ADSEETRRHFSSVRALGEFVAARQS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgcaagcacttgagcacgagatcaaggaattgatcatttcctccctttcgctggaggac atcacgccggaggacatcgatccgaccgcgccgctgttcgtcgagggcctcggcctggat tcgatcgacgcgctggagctgggcctggcgctgcagaagaagtacggtgtcagcctctcg gccgattcggaagaaacccgtcgccatttctccagcgtgcgcgcgctcggcgagttcgtc gccgcccgccagtcgtaa

DBGET integrated database retrieval system