Sulfuracidifex tepidarius: IC006_1527 Help Entry IC006_1527        CDS       T06394                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism step  Sulfuracidifex tepidarius Pathway step03010   Ribosome Brite KEGG Orthology (KO) [BR:step00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     IC006_1527   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     IC006_1527  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:step03011]     IC006_1527    04121 Ubiquitin system [BR:step04121]     IC006_1527   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:step04147]     IC006_1527 Ribosome [BR:step03011]  Ribosomal proteins   Eukaryotes    Small subunit     IC006_1527   Archaea     IC006_1527 Ubiquitin system [BR:step04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    IC006_1527 Exosome [BR:step04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    IC006_1527   Exosomal proteins of colorectal cancer cells    IC006_1527 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Cas12f1-like_TNB Zn_ribbon_SprT Zn_ribbon_RPB9 YhfH DUF1451 EDR4-like_1st Zn_ribbon_Nudix Motif Other DBs NCBI-ProteinID:  BBG24220 UniProt:  A0A510DW19 LinkDB All DBs Position complement(1377774..1378010) Genome browser AA seq 78 aa AA seqDB search MIGTPELRARRVERAMPKKEGGTKAVVRLYYEVQGEQIKLKNKKCPRCGSIMAHHIKPVE RWSCGKCKYTEFVGRKGK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt ttgatagggacgccggaactaagagcaagaagggtggaaagagcaatgcctaagaaggaa ggaggtactaaggccgtcgtaaggctctattacgaggttcaaggagaacagataaaatta aagaacaagaaatgtcctagatgcggaagcataatggcacaccacatcaagccagtagaa aggtggtcttgcggaaagtgtaaatacacagaattcgtaggaaggaaaggtaagtaa

DBGET integrated database retrieval system