Stenotrophomonas sp. 169: ICJ04_03890 Help Entry ICJ04_03890       CDS       T08645                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism steq  Stenotrophomonas sp. 169 Pathway steq00290   Valine, leucine and isoleucine biosynthesis steq00650   Butanoate metabolism steq00660   C5-Branched dibasic acid metabolism steq00770   Pantothenate and CoA biosynthesis steq01100   Metabolic pathways steq01110   Biosynthesis of secondary metabolites steq01210   2-Oxocarboxylic acid metabolism steq01230   Biosynthesis of amino acids Module steq_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine steq_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:steq00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     ICJ04_03890    00660 C5-Branched dibasic acid metabolism     ICJ04_03890   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     ICJ04_03890   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     ICJ04_03890 Enzymes [BR:steq01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      ICJ04_03890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  QNR98066 UniProt:  A0A7H1ANU4 LinkDB All DBs Position complement(935940..936188) Genome browser AA seq 82 aa AA seqDB search MQYRLDLVLHPAEGALLRVIGMAERRGFAPRAIHGAPDAQDQGRWHLQLVVDGTRPPETL CRQIEKIYDCVSVQVTALGVAA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaataccggcttgatctggtgctgcacccggccgaaggtgccctgctgcgggtgatc ggcatggccgagcgccgtggcttcgcaccgcgcgccatccatggcgcccccgatgcgcag gaccagggccgctggcacctgcagttggtggtggacggtacgcgcccgccggagacgctg tgccgccagatcgaaaagatctacgactgcgtctcggtgcaggtcaccgcactgggagtc gccgcatga

DBGET integrated database retrieval system