Stenotrophomonas sp. ASS1: MG068_03015 Help Entry MG068_03015       CDS       T06051                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism stes  Stenotrophomonas sp. ASS1 Brite KEGG Orthology (KO) [BR:stes00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:stes03036]     MG068_03015 (ftsL) Chromosome and associated proteins [BR:stes03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     MG068_03015 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  QBL39546 LinkDB All DBs Position 663200..663463 Genome browser AA seq 87 aa AA seqDB search MSRLLLIILLASTVASAIGVVFVRHRHRQTFIELSRAERKRDDINLEFGRLQLEQATLAE ANRVDRIAREKLGMKFPEAADIVVVRP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccggctgctgctgatcatcctgttggcctcgaccgtggcctcggcgatcggcgtc gtgttcgtgcgtcaccgtcaccggcagacgttcatcgagctgtcgcgcgctgagcgcaag cgcgatgacatcaatctggaattcggccgcctgcagctggaacaggccaccctggccgaa gccaaccgtgtggatcgcatcgcccgcgagaagctcggcatgaagttccccgaggccgcc gacatcgtggtggtgcgcccatga

DBGET integrated database retrieval system