Stenotrophomonas sp. ASS1: MG068_08595
Help
Entry
MG068_08595 CDS
T06051
Name
(GenBank) ATP-binding cassette domain-containing protein
KO
K06147
ATP-binding cassette, subfamily B, bacterial
Organism
stes
Stenotrophomonas sp. ASS1
Brite
KEGG Orthology (KO) [BR:
stes00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
stes02000
]
MG068_08595
Transporters [BR:
stes02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
MG068_08595
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_membrane
ABC_tran
SMC_N
AAA_22
AAA_16
AAA_21
AAA_29
ABC_ATPase
RsgA_GTPase
AAA_25
AAA_33
Zeta_toxin
MMR_HSR1
DUF3851
Motif
Other DBs
NCBI-ProteinID:
QBL40563
LinkDB
All DBs
Position
complement(1799756..1801528)
Genome browser
AA seq
590 aa
AA seq
DB search
MTDKDDAPASTPPLRRLGSLRTLWPFVRRHSGLFTAWLLALAVSSAATLSLPPAVKQMID
HGFSSGGQINRAFALLMLVAVVMALGTAARFYFVSLLGEKVVADLRSQLYAHLIQLGAGF
HDRSRSGELVSRLTADTELLRSVVGSTMSVALRSTVTVIGSLAMLFVTSPRLAAWSLLGI
PLAVLPIIIGARKLRTVARNSQDRIADANSLASETLGAVRTVQAHAREPYERGRFDKALG
DAIGAARRRIGAQSLVTASAILLVFGAIVGVLWLGAHDVIDGRLSAGTLGQFVLYALIGG
GSVGALAEVWNELQRAAGGMGRIGELLQEDIEIRAPAQPHALPQPLRGEIRFDDVVFHYP
QRPDQAALDHFNLHVHPGETVALVGPSGAGKSTVLSMLLRFHDPASGRIDVDGIDVRQAD
PAELRAQLALVPQQPTLFAASARDNIRYGRLQASDAEVEAAARAAEADGFLRALPQGYDS
ELGERGARLSGGQQQRVAIARALLKDAPILLLDEATSALDAQSEHSVQQALERLMAGRTT
LVIAHRLATVLKADRIVVMDQGRIVAEGTHAQLLAEGGLYAELARLQFID
NT seq
1773 nt
NT seq
+upstream
nt +downstream
nt
atgactgacaaggacgacgcccccgcttcgaccccgccgctgcggcgcctcggcagcctg
cgcacgctgtggccgttcgtgcgccgccacagcggcctgttcaccgcctggctgctggcc
ctggcggtgtcttctgcagccacgctgagcctgcctccggcggtgaagcagatgatcgat
cacggtttcagcagcggcggccagatcaaccgtgccttcgccctgctgatgctggtggcg
gtcgtcatggcgttgggcacggccgcgcgcttctacttcgtatcgttgctgggtgaaaag
gtcgtggctgacctgcgcagccagctgtatgcccacctgatccagctgggcgccggcttc
cacgaccgcagccgcagcggagagctggtctcgcgcctgaccgcggacaccgaactgctg
cgcagcgtggtcggctcgaccatgtccgtagcattgcgcagcacggtcaccgtcatcggc
agcctggcaatgctgttcgtcaccagcccgcggctggccgcatggtcgctgcttggcatt
ccgctggcggtgctgccgatcatcatcggcgcgcgcaagctgcgcacggtcgcacgcaac
agccaggaccgcatcgccgatgccaacagcctggccagtgaaaccctgggtgcggtacgc
acggtgcaggcacatgcacgcgagccgtacgagcgcgggcgcttcgacaaggcactcggt
gatgccatcggcgccgcccgtcgccgcatcggcgcacagtcgctggtcaccgccagcgcc
atcctgctggtgttcggcgccatcgtcggtgtgttgtggctgggcgcgcacgacgtcatc
gacggccgcctcagcgccggtacgctgggccagttcgtgctgtatgcattgatcggtggc
ggctcggtgggcgcgctggccgaagtgtggaacgaactgcagcgcgcggccggcggcatg
ggccgcatcggcgaactgctgcaggaagacatcgagatccgcgcgccggcacagccgcac
gcgctgccgcagccgctgcgtggcgagatccggttcgacgacgtggtgttccactacccg
cagcgaccggaccaggccgcactggaccacttcaacctgcacgtgcaccccggcgagacc
gtggcgctggtgggtccgtcgggggcgggcaagagcacggtgctttcgatgctgctgcgc
ttccatgatccagccagcggccgcatcgacgtggacggcatcgacgtgcgccaggccgac
ccggccgagctgcgtgcgcagctggcgctggtgccgcagcagccgacgctgttcgctgcc
agtgcgcgcgacaacatccgctatggccgcctgcaggccagcgacgccgaagtcgaggct
gccgcgcgtgccgccgaggccgatggcttcctgcgcgcgttgccgcagggctatgacagt
gagctgggcgagcgcggtgcccgcctgtccggtggccagcagcagcgtgtggcgattgcc
cgtgcgctgctgaaggatgcgccgatcctgctgctggacgaagcgaccagcgcgctggac
gcgcagagcgagcacagcgtgcagcaagcgctggagcggctgatggcgggccgcaccaca
ctggtcattgcccaccgcctggccaccgtgctcaaggccgaccgcatcgtggtgatggac
cagggccgcatcgtcgccgagggcacgcacgcacagctgctggcagaaggtggactgtac
gctgaacttgcgcgcctgcagttcatcgattga
DBGET
integrated database retrieval system