Stenotrophomonas sp. ASS1: MG068_20340 Help Entry MG068_20340       CDS       T06051                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stes  Stenotrophomonas sp. ASS1 Pathway stes01100   Metabolic pathways stes01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stes00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MG068_20340    00074 Mycolic acid biosynthesis     MG068_20340   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MG068_20340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QBL42742 LinkDB All DBs Position complement(4413505..4413762) Genome browser AA seq 85 aa AA seqDB search MQALEHEIKELIISSLSLEDITPEDIDPTAPLFVEGLGLDSIDALELGLALQKKYGVSLS ADSEETRRHFSSVRALGEFVAARQS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgcaagcacttgagcacgagatcaaggaattgatcatttcctcgctttcgctggaggac atcacgccggaggacatcgatccgaccgcgccgctgttcgtggagggcctcggcctggat tcgatcgacgcgctggagctgggcctggcgctgcagaagaagtacggtgtgagcctctcg gccgattcggaagaaacccgtcgccatttctccagcgtgcgcgcgctcggcgagttcgtc gccgcccgccagtcgtaa

DBGET integrated database retrieval system