Stenotrophomonas sp. P2112: ACEPA4_16560 Help Entry ACEPA4_16560      CDS       T10817                                  Name (GenBank) ACT domain-containing protein   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism stez  Stenotrophomonas sp. P2112 Pathway stez00290   Valine, leucine and isoleucine biosynthesis stez00650   Butanoate metabolism stez00660   C5-Branched dibasic acid metabolism stez00770   Pantothenate and CoA biosynthesis stez01100   Metabolic pathways stez01110   Biosynthesis of secondary metabolites stez01210   2-Oxocarboxylic acid metabolism stez01230   Biosynthesis of amino acids Module stez_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine stez_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:stez00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     ACEPA4_16560    00660 C5-Branched dibasic acid metabolism     ACEPA4_16560   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     ACEPA4_16560   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     ACEPA4_16560 Enzymes [BR:stez01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      ACEPA4_16560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  XGK35055 LinkDB All DBs Position 3591710..3591961 Genome browser AA seq 83 aa AA seqDB search MHYRLDLVLHPAEGALLRVIGMAERRGFAPRAISGAPVAADDGRWHLQLVVDGQRPAETL CRQIEKIYDCVSVQVTAVEGASV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcactaccggcttgacctggtgctgcacccggccgaaggcgcgctgttgcgcgtgatc ggcatggccgagcgccgtggcttcgcgccgcgtgcgatcagcggtgcgccggtggccgcc gacgatggccgctggcacctgcaactggtggtggatggccagcgcccggcggaaacgctg tgccggcagatcgagaagatctacgactgcgtgtccgtgcaggtcaccgccgtggaagga gcatccgtatga

DBGET integrated database retrieval system