Stenotrophomonas sp. P2112: ACEPA4_19475 Help Entry ACEPA4_19475      CDS       T10817                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stez  Stenotrophomonas sp. P2112 Pathway stez01100   Metabolic pathways stez01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stez00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACEPA4_19475    00074 Mycolic acid biosynthesis     ACEPA4_19475   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACEPA4_19475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 TRAF_BIRC3_bd Motif Other DBs NCBI-ProteinID:  XGK35602 LinkDB All DBs Position complement(4231269..4231526) Genome browser AA seq 85 aa AA seqDB search MTKNELFERIVSILTDSFEIETARITPEARLYDDLDIDSIDAVDLIVQLKPLLGRNLQPE AFKAVRTVQDIVDVVYGLLPDQAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccaagaatgaactgttcgaacgcatcgtcagcatcctgaccgacagcttcgagatt gaaaccgcccggatcacccccgaggcccggctctacgacgacctggacatcgacagcatc gatgcggtcgacctgatcgtgcagctcaagccactgctcggccgcaacctgcagccggaa gcgttcaaggccgtgcgcaccgtgcaggacatcgttgatgtcgtgtatggactgctgccg gaccaggcagccgcctga

DBGET integrated database retrieval system