Streptococcus salivarius 57.I: Ssal_01798
Help
Entry
Ssal_01798 CDS
T02088
Symbol
accC
Name
(GenBank) acetyl-CoA carboxylase, biotin carboxylase subunit
KO
K01961
acetyl-CoA carboxylase, biotin carboxylase subunit [EC:
6.4.1.2
6.3.4.14
]
Organism
stf
Streptococcus salivarius 57.I
Pathway
stf00061
Fatty acid biosynthesis
stf00620
Pyruvate metabolism
stf00640
Propanoate metabolism
stf00720
Other carbon fixation pathways
stf01100
Metabolic pathways
stf01110
Biosynthesis of secondary metabolites
stf01120
Microbial metabolism in diverse environments
stf01200
Carbon metabolism
stf01212
Fatty acid metabolism
Module
stf_M00082
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:
stf00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00620 Pyruvate metabolism
Ssal_01798 (accC)
00640 Propanoate metabolism
Ssal_01798 (accC)
09102 Energy metabolism
00720 Other carbon fixation pathways
Ssal_01798 (accC)
09103 Lipid metabolism
00061 Fatty acid biosynthesis
Ssal_01798 (accC)
Enzymes [BR:
stf01000
]
6. Ligases
6.3 Forming carbon-nitrogen bonds
6.3.4 Other carbon-nitrogen ligases
6.3.4.14 biotin carboxylase
Ssal_01798 (accC)
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.2 acetyl-CoA carboxylase
Ssal_01798 (accC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
Biotin_carb_C
Dala_Dala_lig_C
ATP-grasp
ATP-grasp_4
ATP-grasp_3
DUF3182
Motif
Other DBs
NCBI-ProteinID:
AEJ54044
LinkDB
All DBs
Position
complement(1767016..1768386)
Genome browser
AA seq
456 aa
AA seq
DB search
MFKKLLIANRGEIAVRIIRAARELGIQTVAIYSEADKDSLHTMLADEAICIGPAKSTDSY
LNMNRVLSAAIVTEAQAIHPGFGFLSENSKFATLCEEMNIKFIGPSGEVMDKMGDKINAR
AEMIKANVPVIPGSDGEVFTAEEALEVANSLGYPVMLKASAGGGGKGIRKVNTEEELAPA
FESASQEAKAAFGNGAMYIEKVIYPARHIEVQILGDSYGNIVHLGERDCSLQRNNQKVLE
ESPSVAIGKTLRHEIGSAAVRAAKAVNYENAGTIEFLLDEKTGQFYFMEMNTRVQVEHPV
TEFVSGVDIVKEQIRIAAGEKLSVTQDDIEIKGHAIECRINAENPKFNFAPSPGKISNLY
LPSGGVGLRVDSAVYPGYTIPPYYDSMIAKIIVHGENRFEALMKMQRALYELEIDGVVTN
ADFQLDLISDRSVIAGDYDTSFLMETFLPAYQNREE
NT seq
1371 nt
NT seq
+upstream
nt +downstream
nt
atgtttaaaaaattattgattgccaatcgtggtgaaattgcagtgcgtattatccgtgca
gcgcgtgaattgggtatccaaacggttgctatttattctgaagcggataaggattctctc
catactatgcttgctgatgaagctatttgtatcgggcctgcaaaatcaacggattcttat
ttgaatatgaatcgtgtcctatcagctgctattgtgactgaggctcaagctattcatcca
gggtttggtttcttgagtgaaaactctaaatttgccactctctgtgaagaaatgaacatc
aagtttattggtccttcaggggaagtcatggacaagatgggtgataaaatcaatgcccgt
gctgaaatgattaaggctaatgtccctgtaattcctggttcagatggtgaagtctttaca
gctgaggaggctttagaggttgccaacagtcttggttacccagtaatgcttaaggcttct
gctggtggtggcggtaaggggattcgtaaggttaacactgaagaagagttagctcctgcc
ttcgaatctgcgtcacaagaagctaaagcagcctttggtaatggggcaatgtatattgaa
aaagttatttacccagctcgtcatatcgaggttcaaattttgggagatagctatggtaat
attgttcacctaggtgagcgtgattgctctcttcaacgtaataaccaaaaggttttggaa
gaatcaccgtcagttgctattggtaagacacttcgtcacgaaattggttcagcggctgtc
cgtgccgctaaggctgttaattatgaaaatgcgggtactatcgagttccttcttgatgag
aaaacaggtcagttctactttatggaaatgaacacccgtgttcaagttgagcacccagtt
acagaatttgtaagtggtgtggatattgttaaagaacaaatccgtattgccgcaggtgaa
aaactctctgtgacccaagatgatattgaaatcaaggggcatgctattgagtgtcgtatc
aatgcagaaaatcctaagttcaactttgcacctagtccagggaaaattagcaatctctac
ctacctagtggaggtgttggtctccgtgtagacagtgcagtctatcctggctatactatt
ccaccttactatgattcaatgattgccaaaatcattgttcatggagaaaatcgatttgag
gcactcatgaagatgcaacgtgctctttacgagctcgaaatcgatggtgttgtgactaat
gctgacttccagttggatttgatttcagatcgtagcgttatcgctggggattatgatact
tccttcttgatggagaccttcctaccagcttatcagaatcgtgaggaatag
DBGET
integrated database retrieval system