KEGG   Streptococcus salivarius 57.I: Ssal_01798
Entry
Ssal_01798        CDS       T02088                                 
Symbol
accC
Name
(GenBank) acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
stf  Streptococcus salivarius 57.I
Pathway
stf00061  Fatty acid biosynthesis
stf00620  Pyruvate metabolism
stf00640  Propanoate metabolism
stf00720  Other carbon fixation pathways
stf01100  Metabolic pathways
stf01110  Biosynthesis of secondary metabolites
stf01120  Microbial metabolism in diverse environments
stf01200  Carbon metabolism
stf01212  Fatty acid metabolism
Module
stf_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:stf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ssal_01798 (accC)
   00640 Propanoate metabolism
    Ssal_01798 (accC)
  09102 Energy metabolism
   00720 Other carbon fixation pathways
    Ssal_01798 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Ssal_01798 (accC)
Enzymes [BR:stf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Ssal_01798 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Ssal_01798 (accC)
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_4 ATP-grasp_3 DUF3182
Other DBs
NCBI-ProteinID: AEJ54044
LinkDB
Position
complement(1767016..1768386)
AA seq 456 aa
MFKKLLIANRGEIAVRIIRAARELGIQTVAIYSEADKDSLHTMLADEAICIGPAKSTDSY
LNMNRVLSAAIVTEAQAIHPGFGFLSENSKFATLCEEMNIKFIGPSGEVMDKMGDKINAR
AEMIKANVPVIPGSDGEVFTAEEALEVANSLGYPVMLKASAGGGGKGIRKVNTEEELAPA
FESASQEAKAAFGNGAMYIEKVIYPARHIEVQILGDSYGNIVHLGERDCSLQRNNQKVLE
ESPSVAIGKTLRHEIGSAAVRAAKAVNYENAGTIEFLLDEKTGQFYFMEMNTRVQVEHPV
TEFVSGVDIVKEQIRIAAGEKLSVTQDDIEIKGHAIECRINAENPKFNFAPSPGKISNLY
LPSGGVGLRVDSAVYPGYTIPPYYDSMIAKIIVHGENRFEALMKMQRALYELEIDGVVTN
ADFQLDLISDRSVIAGDYDTSFLMETFLPAYQNREE
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgtttaaaaaattattgattgccaatcgtggtgaaattgcagtgcgtattatccgtgca
gcgcgtgaattgggtatccaaacggttgctatttattctgaagcggataaggattctctc
catactatgcttgctgatgaagctatttgtatcgggcctgcaaaatcaacggattcttat
ttgaatatgaatcgtgtcctatcagctgctattgtgactgaggctcaagctattcatcca
gggtttggtttcttgagtgaaaactctaaatttgccactctctgtgaagaaatgaacatc
aagtttattggtccttcaggggaagtcatggacaagatgggtgataaaatcaatgcccgt
gctgaaatgattaaggctaatgtccctgtaattcctggttcagatggtgaagtctttaca
gctgaggaggctttagaggttgccaacagtcttggttacccagtaatgcttaaggcttct
gctggtggtggcggtaaggggattcgtaaggttaacactgaagaagagttagctcctgcc
ttcgaatctgcgtcacaagaagctaaagcagcctttggtaatggggcaatgtatattgaa
aaagttatttacccagctcgtcatatcgaggttcaaattttgggagatagctatggtaat
attgttcacctaggtgagcgtgattgctctcttcaacgtaataaccaaaaggttttggaa
gaatcaccgtcagttgctattggtaagacacttcgtcacgaaattggttcagcggctgtc
cgtgccgctaaggctgttaattatgaaaatgcgggtactatcgagttccttcttgatgag
aaaacaggtcagttctactttatggaaatgaacacccgtgttcaagttgagcacccagtt
acagaatttgtaagtggtgtggatattgttaaagaacaaatccgtattgccgcaggtgaa
aaactctctgtgacccaagatgatattgaaatcaaggggcatgctattgagtgtcgtatc
aatgcagaaaatcctaagttcaactttgcacctagtccagggaaaattagcaatctctac
ctacctagtggaggtgttggtctccgtgtagacagtgcagtctatcctggctatactatt
ccaccttactatgattcaatgattgccaaaatcattgttcatggagaaaatcgatttgag
gcactcatgaagatgcaacgtgctctttacgagctcgaaatcgatggtgttgtgactaat
gctgacttccagttggatttgatttcagatcgtagcgttatcgctggggattatgatact
tccttcttgatggagaccttcctaccagcttatcagaatcgtgaggaatag

DBGET integrated database retrieval system