Streptomyces sp. Go40/10: KBP30_01665 Help Entry KBP30_01665       CDS       T11184                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism stgo  Streptomyces sp. Go40/10 Pathway stgo00253   Tetracycline biosynthesis stgo01056   Biosynthesis of type II polyketide backbone stgo01100   Metabolic pathways stgo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stgo00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     KBP30_01665    00253 Tetracycline biosynthesis     KBP30_01665  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:stgo01004]     KBP30_01665    01008 Polyketide biosynthesis proteins [BR:stgo01008]     KBP30_01665 Lipid biosynthesis proteins [BR:stgo01004]  Polyketide synthase   Component type    KBP30_01665 Polyketide biosynthesis proteins [BR:stgo01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      KBP30_01665     Nonaketide PKS      KBP30_01665     Decaketide PKS      KBP30_01665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UFQ99984 LinkDB All DBs Position complement(301206..301460) Genome browser AA seq 84 aa AA seqDB search MAELTIQDLIDVFNRSNGDQDPVEPEGDPSDVTFAALGFDSLTTLNAVRRIERKHGVALG ENVISEARTPRQLLDRVNAALSAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcagagctgaccatccaggacctgatcgacgtcttcaaccgcagcaacggcgaccag gacccggtcgagcccgagggcgacccgtcggacgtcacgttcgccgccctcggattcgac tcgctcaccacgctgaacgccgtacgccggatcgagcgcaagcacggcgtcgcactcggc gagaacgtgatcagcgaggcccgtacgccgcggcagctgctcgaccgcgtcaacgccgcg ctctccgcggcctga

DBGET integrated database retrieval system