Streptomyces sp. Go40/10: KBP30_27540 Help Entry KBP30_27540       CDS       T11184                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stgo  Streptomyces sp. Go40/10 Pathway stgo00998   Biosynthesis of various antibiotics stgo01100   Metabolic pathways stgo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stgo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KBP30_27540    00074 Mycolic acid biosynthesis     KBP30_27540   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KBP30_27540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 EAL Motif Other DBs NCBI-ProteinID:  UFR04681 LinkDB All DBs Position complement(6418681..6418929) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVEGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDATKYILDHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacccaggaagagatcgtcgaaggtctcgccgaaatcgtgaacgagatcgcc ggcatcccggttgaggacgtcaagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccc gacgaggacgtcaagaacctcaagaccgtcggcgacgcgacgaagtacatcctcgaccac cagggctga

DBGET integrated database retrieval system