Symbiobacterium thermophilum: STH1398 Help Entry STH1398           CDS       T00196                                  Name (GenBank) putative heat shock protein   KO K13993   HSP20 family protein Organism sth  Symbiobacterium thermophilum Brite KEGG Orthology (KO) [BR:sth00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     STH1398  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sth03110]     STH1398 Chaperones and folding catalysts [BR:sth03110]  Heat shock proteins   HSP20    STH1398 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HSP20 Motif Other DBs NCBI-ProteinID:  BAD40383 UniProt:  Q67PL0 LinkDB All DBs Position 1543547..1543831 Genome browser AA seq 94 aa AA seqDB search MRPSDLRVSIVGDRQVVLEGEVAYRHPLPRENLALNECTYGPFSRTVHLPLPVDAAGVAV NLQDGVLTVDMRVRAEAVHLHWQPKEAGSGERPG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt gtgagaccctccgacctgcgggtctcgatcgtgggtgaccgccaggtggtactggagggg gaggtggcttaccgccacccgctcccgcgggaaaacctggcgctcaacgagtgcacatac ggaccgttttcccggaccgtgcacctgcccctgcccgtggacgccgccggggtggccgtc aacctgcaggacggggtgctgaccgtcgacatgcgggtgcgggcggaggccgtgcacctg cactggcagccgaaggaggcgggttccggtgaacgacccgggtaa

DBGET integrated database retrieval system