KEGG   Symbiobacterium thermophilum: STH1540
Entry
STH1540           CDS       T00196                                 
Symbol
cheY
Name
(GenBank) two-component response regulator involved in modulation of flagellar, CheY
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
sth  Symbiobacterium thermophilum
Pathway
sth02020  Two-component system
sth02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sth00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STH1540 (cheY)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    STH1540 (cheY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sth02022]
    STH1540 (cheY)
   02035 Bacterial motility proteins [BR:sth02035]
    STH1540 (cheY)
Two-component system [BR:sth02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   STH1540 (cheY)
Bacterial motility proteins [BR:sth02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    STH1540 (cheY)
SSDB
Motif
Pfam: Response_reg PDE8A_N VpsR B12-binding AmiR_N
Other DBs
NCBI-ProteinID: BAD40525
UniProt: Q67P68
LinkDB
Position
1676843..1677202
AA seq 119 aa
MPKILLVDDAAFMRMRCAKLLTEHGFEVAEAENGQEAIAMYQSYRPDLVLMDITMPVMDG
ITATREIKNLDPDAKVVMVSALGQQTMVIEAIKAGAKDFVVKPFEPEKILSTVRKFVGQ
NT seq 360 nt   +upstreamnt  +downstreamnt
atgcccaagattctgttggtcgacgacgctgccttcatgcggatgcgttgtgcgaagctg
ctcaccgagcatggctttgaggtggccgaggcggagaacggccaggaggccatcgcgatg
taccagagctaccggcctgacctggttctcatggacatcaccatgccggtgatggacggc
attacggcgacccgggagatcaagaacctggatcccgacgcgaaggtggtcatggtctcg
gccctggggcagcagacgatggtcatcgaggccatcaaggcaggcgcgaaggactttgtc
gtcaagcccttcgagcctgagaagatcctgtccacggtcaggaagttcgtgggccagtag

DBGET integrated database retrieval system