Symbiobacterium thermophilum: STH2099 Help Entry STH2099           CDS       T00196                                  Name (GenBank) conserved hypothetical protein   KO K02277   cytochrome c oxidase subunit IV [EC:7.1.1.9] Organism sth  Symbiobacterium thermophilum Pathway sth00190   Oxidative phosphorylation sth01100   Metabolic pathways Module sth_M00155   Cytochrome c oxidase, prokaryotes Brite KEGG Orthology (KO) [BR:sth00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     STH2099 Enzymes [BR:sth01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.9  cytochrome-c oxidase      STH2099 SSDB OrthologParalogGFIT Motif Pfam:  COX4_pro Motif Other DBs NCBI-ProteinID:  BAD41084 UniProt:  Q67MK9 LinkDB All DBs Position 2239981..2240217 Genome browser AA seq 78 aa AA seqDB search MGVILAFITAAEFLILYVRGMSALVVTTLAALSAAKFFLVAAYFMHLRFDPRLLTAIFAV GVTLATLITIAVRFISLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtgggcgtgatcctggctttcatcaccgcggcggagttcctcatcctgtacgtccggggc atgtccgccctggtggtgacgaccctggccgcgctctccgccgccaagttcttcctggtg gccgcctacttcatgcacctgcgtttcgacccgcgcctcctcaccgccatcttcgccgtc ggcgtaaccctggcaaccctgatcacgatcgccgtgcggttcatcagcctggcgtag

DBGET integrated database retrieval system