Streptococcus thermophilus ASCC 1275: T303_03080 Help Entry T303_03080        CDS       T03360                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sthe  Streptococcus thermophilus ASCC 1275 Pathway sthe01100   Metabolic pathways sthe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sthe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     T303_03080    00074 Mycolic acid biosynthesis     T303_03080   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     T303_03080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB ACP_SdgA_C Csd3_N DUF6137 Motif Other DBs NCBI-ProteinID:  AIC23948 LinkDB All DBs Position 546962..547186 Genome browser AA seq 74 aa AA seqDB search MAVFEKVQEIIVEELGKDAEEVKVETTFDELDADSLDVFQVISEIEDEFDIQIETEEGLN TVGDLVAYVEEKTK NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcagtatttgaaaaagtacaagaaatcattgttgaagaacttgggaaagatgcagaa gaagtaaaagtagaaactacttttgacgaacttgatgctgattcacttgatgtattccaa gttatctcagaaatcgaagatgaattcgatattcaaatcgaaactgaagaaggtcttaat acggttggtgaccttgttgcttacgtagaagagaaaactaaataa

DBGET integrated database retrieval system