Caldimonas thermodepolymerans: IS481_04595 Help Entry IS481_04595       CDS       T06911                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sthm  Caldimonas thermodepolymerans Pathway sthm01100   Metabolic pathways sthm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sthm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IS481_04595 (acpP)    00074 Mycolic acid biosynthesis     IS481_04595 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IS481_04595 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1896 Phage_terminase Motif Other DBs NCBI-ProteinID:  QPC32456 LinkDB All DBs Position 936455..936694 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVAESEVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEEA EKITTVQLAIDYALKHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgcgtcaagaagatcattgccgagcaactcggcgtggccgag tcggaagtcaccaacgagaaggctttcgtggccgatctgggcgctgactcgctcgacacc gtcgaactcgtgatggcgctggaagatgaattcggcatcgaaattcccgacgaggaagcc gaaaagatcaccaccgtccagctcgccatcgactacgccctgaagcaccagaaggcctga

DBGET integrated database retrieval system