Caldimonas thermodepolymerans: IS481_10455
Help
Entry
IS481_10455 CDS
T06911
Symbol
clpS
Name
(GenBank) ATP-dependent Clp protease adapter ClpS
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
sthm
Caldimonas thermodepolymerans
Brite
KEGG Orthology (KO) [BR:
sthm00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
IS481_10455 (clpS)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
Motif
Other DBs
NCBI-ProteinID:
QPC30224
LinkDB
All DBs
Position
complement(2237289..2237645)
Genome browser
AA seq
118 aa
AA seq
DB search
MPSDTPKLPATLAQPALPDGGEGTVVVERQSSKVEPPRLYQVVMLNDDYTPMEFVVMVLQ
QYFHRDLETATHIMLKIHHEGRGVCGVYTKDIAATKVELVLAAARRAGHPLQCIMEAA
NT seq
357 nt
NT seq
+upstream
nt +downstream
nt
atgcccagcgacacgcccaagctcccagcaacgctcgcccagcccgcgctgccggacggc
ggggaaggaactgtcgttgtcgaaagacagtcatcgaaggtggagccgccccgtctgtac
caggtggtcatgctgaacgacgactacaccccgatggaattcgtggtgatggtgcttcag
cagtacttccaccgggacctggagacggcgacccacatcatgctgaagatccaccacgaa
ggccgcggcgtctgtggcgtctacaccaaggacatagccgccacgaaagtcgaattggtg
cttgccgccgcgcgccgcgcggggcatcctttgcagtgcattatggaggccgcatga
DBGET
integrated database retrieval system