Streptomyces sp. HP-A2021: MQE23_30885 Help Entry MQE23_30885       CDS       T11535                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sthp  Streptomyces sp. HP-A2021 Pathway sthp00998   Biosynthesis of various antibiotics sthp01100   Metabolic pathways sthp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sthp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MQE23_30885    00074 Mycolic acid biosynthesis     MQE23_30885   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MQE23_30885 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  UOB13187 LinkDB All DBs Position complement(6836540..6836788) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDATDYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgccgagatcgtgaacgagatcgcc ggcatcccggttgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgaggacgtcaagaacctcaagaccgtcggcgacgcgaccgactacatcctcaagcac cagggctga

DBGET integrated database retrieval system