Sulfobacillus thermotolerans: BXT84_15890 Help Entry BXT84_15890       CDS       T06144                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism sthr  Sulfobacillus thermotolerans Pathway sthr03060   Protein export sthr03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:sthr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     BXT84_15890  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     BXT84_15890  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sthr02044]     BXT84_15890 Secretion system [BR:sthr02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    BXT84_15890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AUW95254 LinkDB All DBs Position complement(3232115..3232300) Genome browser AA seq 61 aa AA seqDB search MDDLLSPMHIIVLLIVALLIFGPKRLPEIGGNLAKGIKEFKRAMNGDASSSEKPLDSSHD R NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatgatttgttgtctccgatgcacatcattgtgctgttaatcgtagctttgctgatc tttgggcccaaacgcttgccggaaattgggggcaatttagctaaaggcattaaggaattt aaacgcgcgatgaatggtgacgcctcgtcatcggaaaagcccttagattcctctcatgat cgttaa

DBGET integrated database retrieval system