Streptomyces sp. HU2014: M1P56_05430 Help Entry M1P56_05430       CDS       T11358                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sthu  Streptomyces sp. HU2014 Pathway sthu00998   Biosynthesis of various antibiotics sthu01100   Metabolic pathways sthu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sthu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M1P56_05430    00074 Mycolic acid biosynthesis     M1P56_05430   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M1P56_05430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  UQI43835 LinkDB All DBs Position complement(1258836..1259081) Genome browser AA seq 81 aa AA seqDB search MATQEEIVKGFAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPD EDVKNLKTVGDAAEYILKNQG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggccacccaggaagagatcgtcaagggtttcgccgagatcgtcaacgagatcgccggc atcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgactcg ctgtccatggtcgaggtcgtcgtcgccgctgaggagcgcttcgacgtcaagatccccgac gaggacgtcaagaacctgaagacggtcggcgacgccgccgagtacatcctcaagaaccag ggctga

DBGET integrated database retrieval system