Streptomyces sp. HU2014: M1P56_18615 Help Entry M1P56_18615       CDS       T11358                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sthu  Streptomyces sp. HU2014 Pathway sthu00998   Biosynthesis of various antibiotics sthu01100   Metabolic pathways sthu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sthu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M1P56_18615    00074 Mycolic acid biosynthesis     M1P56_18615   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M1P56_18615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UQI46207 LinkDB All DBs Position 4388416..4388712 Genome browser AA seq 98 aa AA seqDB search MSEAVQHPFTYIRDYLASAFGLTADELTGDRTFGSLELDSIAQVEMFVTLSDHYGVQLDD SLAGDEMTLRQTADLVSAALESGGGRPKPQDAGAVAPG NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgagcgaggccgtgcagcaccccttcacctacatccgcgactacctggcatcggcgttc ggcctgaccgcggacgagctcaccggcgaccgcaccttcggcagcctggagttggactcc atcgcccaggtggagatgttcgtgacgctctccgaccactacggcgtccagctggacgac tcgctggccggcgacgagatgaccctgcggcagacagccgacctcgtctcggcggccctg gagagcggcggtgggcggccgaagccgcaggacgccggagcggtagcgccgggctga

DBGET integrated database retrieval system