Streptomyces sp. HU2014: M1P56_22790 Help Entry M1P56_22790       CDS       T11358                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sthu  Streptomyces sp. HU2014 Pathway sthu00253   Tetracycline biosynthesis sthu01056   Biosynthesis of type II polyketide backbone sthu01100   Metabolic pathways sthu01110   Biosynthesis of secondary metabolites Module sthu_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:sthu00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     M1P56_22790    00253 Tetracycline biosynthesis     M1P56_22790  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sthu01004]     M1P56_22790    01008 Polyketide biosynthesis proteins [BR:sthu01008]     M1P56_22790 Lipid biosynthesis proteins [BR:sthu01004]  Polyketide synthase   Component type    M1P56_22790 Polyketide biosynthesis proteins [BR:sthu01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      M1P56_22790     Nonaketide PKS      M1P56_22790     Decaketide PKS      M1P56_22790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  UQI46975 LinkDB All DBs Position 5347996..5348280 Genome browser AA seq 94 aa AA seqDB search MTEPMDIDTLRRILVACAGEDETAAPAGDILDIPFTDLGYDSLALMESAARIKQDFGVDI ADDVLTELETPRALLDLVNGSVRAGRPAEEVRGA NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaccgaaccgatggacatcgacaccctgcgccggatactcgtggcctgcgcgggcgag gacgagacggccgctccggccggcgacatcctcgacatccccttcacggacctgggttac gactcgctcgccctgatggagagcgcggcccggatcaagcaggatttcggggtggacatc gccgacgacgtcctgaccgagctggagacgccgcgtgcgctgctcgacctcgtcaacgga tccgtgcgcgccggacggccggccgaggaggtgaggggcgcgtga

DBGET integrated database retrieval system