Streptomyces sp. ID38640: G7Z12_03470 Help Entry G7Z12_03470       CDS       T11207                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stid  Streptomyces sp. ID38640 Pathway stid00998   Biosynthesis of various antibiotics stid01100   Metabolic pathways stid01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stid00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G7Z12_03470    00074 Mycolic acid biosynthesis     G7Z12_03470   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G7Z12_03470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QIK11038 LinkDB All DBs Position 867638..867844 Genome browser AA seq 68 aa AA seqDB search MLVQRFGVPPTDITEEAALRSLRLDSLALEELRVLIEERLDIDLDEVSLTPRNTVGQLVA AVDGNVPA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt ttgctggtccagcgattcggggttcccccgaccgacatcaccgaagaggcggcgctgcgc agcctgcgcctggactccctggcactggaggagctccgcgtcctcatcgaggagcggctg gacatcgacctcgacgaggtgtcgctgaccccgcggaacaccgtgggccagctggtggcg gccgtcgacggcaacgttccggcatga

DBGET integrated database retrieval system