Streptomyces sp. ID38640: G7Z12_25860 Help Entry G7Z12_25860       CDS       T11207                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stid  Streptomyces sp. ID38640 Pathway stid00998   Biosynthesis of various antibiotics stid01100   Metabolic pathways stid01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stid00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G7Z12_25860    00074 Mycolic acid biosynthesis     G7Z12_25860   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G7Z12_25860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QIK08932 UniProt:  A0A6G7T0G2 LinkDB All DBs Position complement(6012936..6013184) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPTEDVQVDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATEYILKHQS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgccgagatcgtgaacgagatcgcc gggatccccaccgaggacgtccaggtggacaagtccttcaccgacgacctggacgttgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtgaagatcccg gacgacgacgtcaagaacctcaagacggtcggcgacgcgaccgagtacatcctcaagcac cagagctga

DBGET integrated database retrieval system