Streptomyces tirandamycinicus: DDW44_20215 Help Entry DDW44_20215       CDS       T06843                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism stir  Streptomyces tirandamycinicus Brite KEGG Orthology (KO) [BR:stir00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     DDW44_20215 Enzymes [BR:stir01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      DDW44_20215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like Thioredoxin_2 GST_N_3 Thioredoxin GST_N_2 Motif Other DBs NCBI-ProteinID:  AWI30842 UniProt:  A0A2S1SWP5 LinkDB All DBs Position complement(4555020..4555277) Genome browser AA seq 85 aa AA seqDB search MQGTLTMYSTTWCGYCRRLKSQLDREGISYVEINIEEDPQSAAFVEKANNGNQTVPTVLV VPPNGGENIVMTNPSLAQVKQALAI NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcagggaactctgacgatgtacagcaccacctggtgcggctactgccggcggctgaag agccagctggaccgcgaggggatctcgtatgtcgagatcaacatcgaggaggacccgcag tcggccgcgttcgtcgagaaggcgaacaacggcaaccagaccgtcccgaccgtcctcgtg gtgccgccgaacggcggcgagaacatcgtcatgacgaaccccagcctggcccaggtgaag caggccctcgcgatctga

DBGET integrated database retrieval system