Streptomyces tirandamycinicus: DDW44_27915 Help Entry DDW44_27915       CDS       T06843                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism stir  Streptomyces tirandamycinicus Pathway stir00253   Tetracycline biosynthesis stir01056   Biosynthesis of type II polyketide backbone stir01100   Metabolic pathways stir01110   Biosynthesis of secondary metabolites Module stir_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:stir00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     DDW44_27915    00253 Tetracycline biosynthesis     DDW44_27915  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:stir01004]     DDW44_27915    01008 Polyketide biosynthesis proteins [BR:stir01008]     DDW44_27915 Lipid biosynthesis proteins [BR:stir01004]  Polyketide synthase   Component type    DDW44_27915 Polyketide biosynthesis proteins [BR:stir01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      DDW44_27915     Nonaketide PKS      DDW44_27915     Decaketide PKS      DDW44_27915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF3219 Motif Other DBs NCBI-ProteinID:  AWI32202 UniProt:  A0A2S1T0L9 LinkDB All DBs Position complement(6408131..6408385) Genome browser AA seq 84 aa AA seqDB search MVALTSERLFDILRECAGEEEAVTNKENAVDMKFTDLGYDSLALLETAARVSREYDVDIP EEDLSEVTTPAGFLTVVNTLLKVA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggtggcgctgacaagtgaaaggctcttcgacatcctgcgggagtgcgcgggggaagag gaggccgtaaccaacaaggaaaacgcggttgacatgaaattcacggacctcgggtacgat tcgctggccctgctggagacagcggcccgggtctcgcgcgagtacgacgtggatattccc gaggaggacctctccgaggtcacgaccccggccggcttcctgacggttgtcaatacactg ctgaaagtggcttga

DBGET integrated database retrieval system