Streptococcus thermophilus LMG 18311: stu0029 Help Entry stu0029           CDS       T00213                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stl  Streptococcus thermophilus LMG 18311 Pathway stl01100   Metabolic pathways stl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     stu0029 (acpP1)    00074 Mycolic acid biosynthesis     stu0029 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     stu0029 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AAV59759 UniProt:  Q5M6J9 LinkDB All DBs Position 32578..32823 Genome browser AA seq 81 aa AA seqDB search MSRVEILQEMQLVIQEQLDREDIVLTEATKLNDLGVDSIELMEFIINLEDEFPLEISDNT IDHMDKVSDLLDYLSEQLNNK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtagagtagaaattcttcaggaaatgcagctcgttattcaagagcaattggataga gaggacattgttttaaccgaagctaccaaattaaatgacttgggtgtagattcaatagag cttatggagttcattattaatttggaggatgagtttcccctagagatttctgataatacc attgatcatatggataaggtatcagatttgttagactatttgtctgagcaattgaataac aaataa

DBGET integrated database retrieval system