Salinispora tropica: Strop_0677 Help Entry Strop_0677        CDS       T00504                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism stp  Salinispora tropica Pathway stp01100   Metabolic pathways stp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Strop_0677    00074 Mycolic acid biosynthesis     Strop_0677   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Strop_0677 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABP53154 UniProt:  A4X2Q4 LinkDB All DBs Position 762411..762680 Genome browser AA seq 89 aa AA seqDB search MTDRPHINDAVKRLVVRESRISVDPGTIDDLEPLNGDLLRVNSLGFLGMLVRLEDELDVM LPDDIFAGRAFTTVADLVDVVVDLVKEES NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgaccggcctcacatcaacgacgcagtcaaacggctggtcgtacgcgagtcacgg atctcggtcgaccccggcaccatcgacgacctcgagccactcaacggtgacctgctacga gtcaactcgctgggcttcctcggcatgctcgtgcggctcgaggacgaactcgacgtcatg ttgccggacgacatcttcgccgggcgggccttcacgaccgtcgccgacctggtcgacgtc gtcgtggatctggtgaaggaggagtcgtga

DBGET integrated database retrieval system