Streptomyces sp. PBH53: QR97_17435 Help Entry QR97_17435        CDS       T10303                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism stpb  Streptomyces sp. PBH53 Brite KEGG Orthology (KO) [BR:stpb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:stpb03032]     QR97_17435    03036 Chromosome and associated proteins [BR:stpb03036]     QR97_17435    03400 DNA repair and recombination proteins [BR:stpb03400]     QR97_17435 DNA replication proteins [BR:stpb03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     QR97_17435 Chromosome and associated proteins [BR:stpb03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     QR97_17435 DNA repair and recombination proteins [BR:stpb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       QR97_17435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta DUF7342 HU-HIG Motif Other DBs NCBI-ProteinID:  AKN71350 UniProt:  A0A0H4C3D3 LinkDB All DBs Position 4006499..4006780 Genome browser AA seq 93 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAAFAETVGEIVAKGDEKVTIPGFLTFERTHRAART ARNPQTGEPINIPAGFSVKVTAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgcgctggccgaccgcgccgaggtgacccgcaaggac gccgacgccgtgctggccgcgttcgccgagaccgtcggcgagatcgtcgccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgcacc gcgcgcaacccgcagaccggcgagcccatcaacatcccggccggcttcagcgtgaaggtc accgcgggcagcaagctcaaggaagccgccaagggcaagtaa

DBGET integrated database retrieval system