Spirochaeta thermophila DSM 6578: Spith_0918 Help Entry Spith_0918        CDS       T02016                                  Name (GenBank) hypothetical protein   KO K03586   cell division protein FtsL Organism stq  Spirochaeta thermophila DSM 6578 Brite KEGG Orthology (KO) [BR:stq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:stq03036]     Spith_0918 Chromosome and associated proteins [BR:stq03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Spith_0918 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC Med21 YmiC Motif Other DBs NCBI-ProteinID:  AEJ61192 UniProt:  G0GCA7 LinkDB All DBs Position 1046227..1046496 Genome browser AA seq 89 aa AA seqDB search MRYLRWLGVFLFSLLFFLNIWQGYRYAALKEELRRLELEQQRMVEENKKLITAVEALRHP QRIERLGEESLGLGPVGDRLVIEVEGGGE NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcgctaccttaggtggctcggtgtgtttctcttttctctcctcttctttctcaatatc tggcaggggtaccggtatgcggccctcaaggaggaactccggcggctcgaactggagcag caacggatggtggaggagaacaagaagctcatcaccgcggtggaggccctcagacatcct cagcggatagagcgcctcggcgaggaatccctgggcctcgggcccgtgggagaccgtctc gtcatcgaggtggaaggagggggggaatga

DBGET integrated database retrieval system